SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322311.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322311.1.57290
Domain Number 1 Region: 115-428
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.86e-90
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.0000000564
Further Details:      
 
Domain Number 2 Region: 10-100
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 2.29e-22
Family Anticodon-binding domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011322311.1.57290
Sequence length 433
Comment aspartate--tRNA(Asn) ligase [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MENRTYTADAEPGETVTVAGWVHEVRDLGGIAFLILRDTTGQIQVKFEKDEMDDELVETG
LNVARESVITVSGDVEEEPRAPTGVEVTPETVEVLSEADTELPLDPTGKVDAELSTRLDN
RTLDLRSEEGQAIFEIRAEVLRAVREAFRDANATEINTSKIVATGTEGGTELFPITYFGE
EAFMNQSPQLFKQLVAGSNIERVFEIGPIFRAEEHNTPRHLNEATSIDFEGAFCDHTDAM
DVCEQVVTAAYEAVAENCTDQLEALGITEEFEVPETPFPRLSYEEAIERINATGELDEQL
VWGDDLPTEGEKALGDDVGGHYFITDWPAEIKPFYIMDHEDGELSTGFDMMHPRMELVSG
GQREHRREELIAGFEQQGLEPEAFEYYTKMFKYGMPPHAGWGLGGERLLMTMLDLDNIRE
AVLFPRDRQRLSP
Download sequence
Identical sequences Q3IT59
348780.NP1168A gi|76801236|ref|YP_326244.1| WP_011322311.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]