SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322346.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322346.1.57290
Domain Number 1 Region: 15-190
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 1.86e-35
Family RNA methyltransferase FtsJ 0.0000735
Further Details:      
 
Domain Number 2 Region: 189-252
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 6.28e-16
Family TRAM domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011322346.1.57290
Sequence length 252
Comment 23S rRNA methyltransferase [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MTRKDDYYNRAKQQGYRSRAAYKLKQLDEAADLINEGDTVVDLGAAPGGWLQVANELAGE
AGTVVGVDLQRIDPIEGVETVRGDMTEDATREKVRALVGEADVVISDMAPNMTGEYSLDH
ARSVHLARMAFETALDLLAPNGDLVAKVFEGPDTDDLRADIDREFEYVRTIHPDASRDSS
SELFMVAKGRLTAPVREGDTLEVEIDNLGDEGDGVAKVDGYTLFVSGAEPGDAPEVRVTD
VKPRFGFAETLE
Download sequence
Identical sequences Q3IT24
gi|76801271|ref|YP_326279.1| 348780.NP1238A WP_011322346.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]