SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011322375.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011322375.1.57290
Domain Number 1 Region: 43-107
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000000428
Family TRAM domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011322375.1.57290
Sequence length 158
Comment deoxyribonuclease [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MPDCPLADDCPSFSERIEGMGCQHYGDRGGAEWCSHYSQPINDLKQQPVQVGEEVVVDVG
DIHESGAGVGRTEDGFIVMVDGVLPEARAKVRITEVRSNHARADEVERLPLEEDEDGSSE
PDTTDDSDPGAEEADDRSDRERALDREELGSRENFWGN
Download sequence
Identical sequences A0A1U7EUU4
gi|76801300|ref|YP_326308.1| 348780.NP1298A WP_011322375.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]