SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011323325.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011323325.1.57290
Domain Number 1 Region: 233-626
Classification Level Classification E-value
Superfamily DHH phosphoesterases 1.7e-43
Family Exonuclease RecJ 0.022
Further Details:      
 
Domain Number 2 Region: 25-83
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.00000000296
Family Cold shock DNA-binding domain-like 0.0093
Further Details:      
 
Weak hits

Sequence:  WP_011323325.1.57290
Domain Number - Region: 122-191
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.000146
Family Anticodon-binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011323325.1.57290
Sequence length 635
Comment hypothetical protein [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MTHSAAGDAGGNRSAEVVYELAPGCTLEDIEAGAAYLATVNGVVDYGVFVDLSEHVSGLV
HESNLQNDHDVGDELVVELVEERENGDLGFEELDADPDEVDRTSVNEGTAARTGDLADHV
GETVHLEGDIVQIKQTAGPTIFSLRDGDGVVPCAAFESAGVRAYPAVELDDTVRITGAVE
THEGALQLEVDKLVRLRGEAADEVRTELDADLEARAAPADVEPLIEWPAFEKLHDDLADL
ARRLRRAVLESRPIRLRHHADGDGMCASLPVQIALERFIDEVHHDPDAGRHLLKRLPSKA
PFYEMEDVTRDLNFALEDRERHGQRLPLLFMVDNGSTEEDTPAYRAVSEYDIPVLVVDHH
HPDPDAVGPLVEQHVNPYLHDEDYRITTGMMCVELARMIDPSLTEELEHVPAVAGLSDRS
KADAMDQYLELAADAGYDESDLQDIGEALDYAAHWLRYQSGRNLIKDILNLDCDDAARHR
ELVSFLADRAERDVAEQIDDAEPHVEHERLDNGAHLYRLDVENHARRFTYPAPGKTTGEL
HDRKVTETGDPVITIGYGPDFAVLRSDGVRLDIPNMVTELKSEVDGAGVSGGGHLVVGSI
KFVPGMREPVIDALVEKMADAELDEDLRSTLVRDD
Download sequence
Identical sequences A0A1U7EX53
WP_011323325.1.57290 348780.NP3224A gi|76802252|ref|YP_327260.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]