SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011323342.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011323342.1.57290
Domain Number 1 Region: 152-209
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000224
Family CodY HTH domain 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011323342.1.57290
Sequence length 215
Comment hypothetical protein [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MRTYISPIGYDTRRATRPVINQGMQGGDMLVLLRPEAESDTEWANQTIADVKQYLHEAEP
AFEINVERVETASFEATVRDCCRLLGDIEPDRETIVSLGGGARDVLLPLTVASLVYANQI
DTALFFSDLDSTVREWVLPDLTTQIPDRTTDTFTIILEAGGWISLSEIVSRTSHSKSTVV
RHVNDLEEAGVIQADTSEKAKRVRVTFSGEILSMA
Download sequence
Identical sequences A0A1U7EX74
gi|76802269|ref|YP_327277.1| 348780.NP3260A WP_011323342.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]