SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011323526.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011323526.1.57290
Domain Number - Region: 252-298
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0148
Family CAP C-terminal domain-like 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011323526.1.57290
Sequence length 318
Comment hypothetical protein [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MERHRVSPADLFSLGVVSELETAIEAVAAGRNVAVVAPPLAGRAAVLDIVEDMVGESVRE
QATERTDTADAPIRLYEDCHRLYLRHIGGFSELDAFLDGMAETSAVHVTTWNAYAWAYLN
QAKSVGNSFDSVITLDKPDSETVTSWLESLAADGLTYVRDSADGPSGFDPQKIHSLTTLR
EQLRLLCFADGDDDDPKTAVFDSVTRITGGNPGVAKTIWNAIEAEAATEGEVRTSMVTEH
EAEVSELSYDDAYALLAVLANGSITQSELEAVVDESLDRTLRRFEKQGVVELTGDGISVA
PPALKPVVEHLTNRRLLW
Download sequence
Identical sequences A0A1U7EXI5
WP_011323526.1.57290 348780.NP3630A gi|76802453|ref|YP_327461.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]