SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011323644.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011323644.1.57290
Domain Number 1 Region: 328-410,479-657
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.43e-41
Family Tandem AAA-ATPase domain 0.002
Further Details:      
 
Domain Number 2 Region: 90-296
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.33e-30
Family Tandem AAA-ATPase domain 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011323644.1.57290
Sequence length 958
Comment helicase [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MSSQLPSNIQPGSVVENRNRLWRVDAVDGNVVTATPLDGNTADRHRFYTPVENIEEGSLE
PPDPKKLGNPEFQRLLNRAYRLSMLHGTAPLVSLQRSRVIPTEYQLTPVVMALDMPRVRM
LLADDVGLGKTIEAGLITSELMARNKADRILIITPANLREQWREAFNYFFHIDADIISRR
HRKAMEKEIPPGTSPWEHFSKLIVSIDYAKQNSVRHEILDQDWDLVIIDEAHQAAKPHES
GANETVDMQRWDFATEITDHAEHCLLLTATPHNGYTDSFASLIRMLDVDAVSGPRHDPTI
HRDIAQRHVVQRRRDDVKQWFSDSDGQSPFPERDQDEVRVTPTEYEQETYDAVREYGELL
MSSAQRSSSKSQTLARWSVIHFLKRALSSPEALRQSLKNRQDKLEDRLEDLDEEDTQTVI
EETAGISESMAQANALDDDPGEEYSEEEVGERVERVVTGDKAAIERELDVLENVAEKAER
VTKTRDAKLQRLLDETLPNRFQYPRVIIFTKYVDTLEYLEEQIKDSQSDETEVFTLHGSL
NEAQRKERFKEFEDSTRGVLIATDVISEGMNLQHAANQIIHYELPWNPNRLEQRNGRIDR
YGQKNDEVVIRTMVVEDQMDVAILEKLVQKANNIRQEYGFSPPYFGDDEGILELLKDEGI
DAGVPQATLEEFGGGSAPAERESASVFDDQTLDRIKSESFYGHTEVGLQEVQKRQEETHQ
RIGGQGTLEQFVKSALDLFSCSYEMNVQGHLDIKITADRLQGPDIKREYEDVTFDPNEAS
QSSDTEMLDIAHPLVQRLIEAVKETALTDEDRYGRTAIRGTNEVSEPTAVYTALVRYVAD
TKPDPTIMEELVQVGLPIYGDEPLEQDIVEALEESEAKPVQRTSMEKEDDLKDALGHGAF
EQTLQRRAEQRRDKIVEQRTEMRAELEKSGSGSWLSGIDDVEIASKDLLTVTVYYGSN
Download sequence
Identical sequences A0A1U7EXV3
348780.NP3872A gi|76802571|ref|YP_327579.1| WP_011323644.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]