SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011323687.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011323687.1.57290
Domain Number 1 Region: 168-278
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.88e-22
Family Single strand DNA-binding domain, SSB 0.0043
Further Details:      
 
Domain Number 2 Region: 59-156
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 9e-22
Family Single strand DNA-binding domain, SSB 0.0054
Further Details:      
 
Domain Number 3 Region: 283-399
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 0.0000000000113
Family Single strand DNA-binding domain, SSB 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011323687.1.57290
Sequence length 425
Comment replication protein A [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MSLDDAAEDLASSLGVDKAEVKEDLEKLVSYSVPMDEAKQSLRRKYGDEGSTGGGADDAP
TTDIEEITTDDDRVTVTARVLTVGKRSIRYDGDDQTIFEGELADGTGRISYTAWTDFSLT
PGDTVTVGNAGVREWDGNPELNLGQSTTVTLEEEPLSVPYDVGGQRNLIDLEPGDRGRTV
EVRVLEVEQKTIDGRDGETEILDGVFGDETSRLPFTDWDPHDAIEAGTSVRLEDVYVDEF
RGVPSVNVTAFTTVEAIPEVAVSDEATAMSVQEAVDAGGVYDVELTGNIIEVRDGSGLIQ
RCPECGRVVQNDQCRSHGKVDPEDDLRVKAILDDGTDSVTVILGRELTEEVYGGTLTDAL
EAARDEMDRGVVADDIAETLAGREYRVRGSLSVDEYGANLDATDFEESGGDPASRAERFL
AEVGR
Download sequence
Identical sequences A0A1U7EXY5
WP_011323687.1.57290 348780.NP3960A gi|76802614|ref|YP_327622.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]