SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011324478.1.57290 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011324478.1.57290
Domain Number 1 Region: 5-87
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000248
Family Lrp/AsnC-like transcriptional regulator N-terminal domain 0.036
Further Details:      
 
Domain Number 2 Region: 73-148
Classification Level Classification E-value
Superfamily Dimeric alpha+beta barrel 0.000000000282
Family Lrp/AsnC-like transcriptional regulator C-terminal domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011324478.1.57290
Sequence length 165
Comment transcriptional regulator [Natronomonas pharaonis]; AA=GCF_000026045.1; RF=representative genome; TAX=348780; STAX=2257; NAME=Natronomonas pharaonis DSM 2160; strain=Gabara; AL=Complete Genome; RT=Major
Sequence
MTGELDERDFRILCAIAEHETFSSEDLHEETGIPKSTVHYRIQNMKDEGVIKNELFEFDR
EKIGIEITLISEVWAEFGEGYHDTVGEKLSEIEGVNQVYFTMGDTDFVAIARLTSRDMVE
QLVEDYESIDEIQRTSSKFAISTIKEDISISALGDYSVETLLDSD
Download sequence
Identical sequences Q3ILY9
gi|76803457|ref|YP_327726.1|NC_007427 gi|76803457|ref|YP_327726.1| 348780.NP6200A WP_011324478.1.57290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]