SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011330535.1.91979 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011330535.1.91979
Domain Number 1 Region: 6-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.88e-57
Family Glutathione peroxidase-like 0.0000171
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011330535.1.91979
Sequence length 193
Comment thioredoxin family protein [Nitrosococcus oceani]; AA=GCF_000012805.1; RF=representative genome; TAX=323261; STAX=1229; NAME=Nitrosococcus oceani ATCC 19707; strain=ATCC 19707; AL=Complete Genome; RT=Major
Sequence
MARTESMMLDLGTQAPDFQLLEPATGRTVSLADFKGAGGLLVIFMCNHCPYVKHISSALS
QFAREYQPKGLAIVGISVNDVENYPDDSPEKMAEEVEAQGYIFPYLYDETQEIAKAYKAA
CTPDFFLFDKNHKLVYRGQFDDSRPGNDLPVTGEDLQTAVKAVLSGQPIPNEQRPSMGCN
IKWKPGNEPDYFG
Download sequence
Identical sequences A0A0E2ZNN5 Q3JCE8
WP_011330535.1.20919 WP_011330535.1.60716 WP_011330535.1.77844 WP_011330535.1.91979 gi|77164503|ref|YP_343028.1| 323261.Noc_0989

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]