SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011330900.1.20919 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011330900.1.20919
Domain Number 1 Region: 116-151,180-258
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 2.65e-30
Family Glutathione S-transferase (GST), C-terminal domain 0.0098
Further Details:      
 
Domain Number 2 Region: 37-130
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-18
Family Glutathione S-transferase (GST), N-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011330900.1.20919
Sequence length 289
Comment thiol:disulfide oxidoreductase [Nitrosococcus oceani]; AA=GCF_000740745.1; RF=na; TAX=314279; STAX=1229; NAME=Nitrosococcus oceani C-27; strain=C-27; AL=Scaffold; RT=Major
Sequence
MSNEYVTPKVWVFEGESGGTWSKINRPVSGATHEATLPVGTQPLQLYSMGTPNGQKVTIM
LEELLALGEEGAEYDAHLIEIDEGDQFSTGFVKVNPNSKIPALLDCSAENPIRIFESGAI
LLYLAEKFGHFLPRQVAKRTEVLNWLFWLQGSAPYLGGGFGHFYSYAPEKIEYAINRFTM
EVKRQLDLLDKQLAARPFIAGDDYSIADMAIWPWYGNLVLGNLYDSADFLDVRSYQNARR
WADDVGQRPALQRGRIVNRTWGEPWEVLAERHEASDINEVLKLKPSKPS
Download sequence
Identical sequences A0A0E2Z023 Q3J919
323261.Noc_2217 WP_011330900.1.20919 WP_011330900.1.60716 WP_011330900.1.77844 WP_011330900.1.91979 gi|77165682|ref|YP_344207.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]