SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011338529.1.80699 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011338529.1.80699
Domain Number 1 Region: 516-737
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00000000000187
Family Glycosyl hydrolases family 16 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011338529.1.80699
Sequence length 793
Comment hypothetical protein [Rhodobacter sphaeroides]; AA=GCF_000269625.1; RF=na; TAX=272943; STAX=1063; NAME=Rhodobacter sphaeroides 2.4.1; strain=2.4.1; AL=Chromosome; RT=Major
Sequence
MAIDPDIIPLLDAQVAQVAALEARLAAHVKTSAQQDADLAARIEGVKADLRTLGTQEGAA
SAGLLVRLSALEAALPGLADSSSRGDTELSARLDTLSASSRSGDSALGQTLTGVQAAVSR
IDTGLTAALGRIDALEEASPPTADLFEDGTGTAPRGWTQVWHALSWIEKGGYLQAQPASG
ARTLLACDALNGTRDLEMLALFTFAEAAGYAGLALRASGAAGAETGYRVMFYTNPAGPSL
QVARFSAGVATGLSNVAFARAAAGDYWLRVRLVGATLSWKAWARGAAEPADWTGSLTDPT
PVTSAGWAGICASGVNVAVTVRCQQISWAVLPRPADTTTAETLPWDLLGTLPLPVIAFDD
EAARTVHVPPGQRYAHVKVTADQPIRMTAIGRPSVSNVNGGGMNVGGDQALWVGDYWAVW
RPGDDREMWLTVDMQYGRAAGNRVAFSLATDMGGWRSASPVTGFIEIREGAVNALPATLP
RHRAPMRLTITGSPKASLDPATAQWSDTGFAGNAATGTPCWRARLAHGYTQDGNGEVGLY
MNADVWPTQSAAPHARVTDRQGRKAIRLRSCRLPAPVTLSAEGGDRIFYHQASALIAQNL
PEWRGKTGVWTARCMTANRLYSWPAFWLLADGWPPELDIFEHFNGIYGSWPDGGWSTCTG
HSGPYGGLDVKTRTPLKFDLRKLGFASFDAYSQIHDYAAYVDRDWIYAFVDGIEVYCTPN
IARHQDWDAAWSLYPMFDVAAKFANPSTYAYADGSGDMHVYGAAHYATSAVALVPCTDAR
PWPNGRQLPDPTF
Download sequence
Identical sequences Q3IZL9
272943.RSP_6136 WP_011338529.1.22285 WP_011338529.1.62547 WP_011338529.1.80699 WP_011338529.1.8565 YP_353916.1.90827 gi|77464412|ref|YP_353916.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]