SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011345831.1.23534 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011345831.1.23534
Domain Number 1 Region: 18-103
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.6e-18
Family PDI-like 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011345831.1.23534
Sequence length 109
Comment MULTISPECIES: thiol reductase thioredoxin [Xanthomonas]; AA=GCF_001008885.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=586; AL=Scaffold; RT=Major
Sequence
MGFVRQYATQAPERSAVEAQTGLQVLEFGTDWCGHCIAAQPLLQKLLGGYEAIDYRKIED
GKGRPLGRSFRVKLWPTIILLRDGQELARAVRPQTREDLQDLLSLLDAA
Download sequence
Identical sequences Q3BZK2
gi|78045636|ref|YP_361811.1| WP_011345831.1.100156 WP_011345831.1.10442 WP_011345831.1.11230 WP_011345831.1.13735 WP_011345831.1.199 WP_011345831.1.21303 WP_011345831.1.21317 WP_011345831.1.2259 WP_011345831.1.23534 WP_011345831.1.27112 WP_011345831.1.29361 WP_011345831.1.3003 WP_011345831.1.331 WP_011345831.1.37942 WP_011345831.1.39371 WP_011345831.1.40690 WP_011345831.1.43396 WP_011345831.1.44794 WP_011345831.1.46449 WP_011345831.1.46677 WP_011345831.1.49886 WP_011345831.1.55770 WP_011345831.1.57452 WP_011345831.1.60785 WP_011345831.1.64411 WP_011345831.1.66420 WP_011345831.1.67180 WP_011345831.1.67877 WP_011345831.1.75734 WP_011345831.1.772 WP_011345831.1.79359 WP_011345831.1.81489 WP_011345831.1.8544 WP_011345831.1.89212 WP_011345831.1.89360 WP_011345831.1.94946 WP_011345831.1.99285 316273.XCV0080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]