SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011346264.1.100156 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011346264.1.100156
Domain Number 1 Region: 175-322
Classification Level Classification E-value
Superfamily GST C-terminal domain-like 3.34e-37
Family Glutathione S-transferase (GST), C-terminal domain 0.0068
Further Details:      
 
Domain Number 2 Region: 41-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000176
Family Glutathione S-transferase (GST), N-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011346264.1.100156
Sequence length 324
Comment glutathione-dependent reductase [Xanthomonas euvesicatoria]; AA=GCF_000009165.1; RF=na; TAX=316273; STAX=456327; NAME=Xanthomonas campestris pv. vesicatoria str. 85-10; strain=85-10; AL=Complete Genome; RT=Major
Sequence
MGLLVDGKWQDRWYDTSKSEGRFERSQSQFRNWVTRDGSAGPHGQGGFKAASGRYHLYVS
LACPWAHRTLIFRRLKGLESMIDVSIVHWLMRENGWTFADGPGVVGDTESHAQYLYEVYL
KADPHYSGRVTVPVLWDRERKTVVSNESADIIRMFNSAFDAIGAADGDFYPQPLREQIDA
VNARVYDTVNNGVYKAGFATTQAAYDEAVVPLFESLDWLEARLSAQRYLCGDRLTEADWR
LFTTLVRFDAVYVGHFKCNLRRIADYPQLSGFLRELYQMPGIADTVNFQHIKGHYYQSHD
TINPNGIVPMGPLLDLDAPHGRGG
Download sequence
Identical sequences Q3BXZ5
gi|78046193|ref|YP_362368.1| 316273.XCV0637 WP_011346264.1.100156 WP_011346264.1.331 WP_011346264.1.46449 WP_011346264.1.46677 WP_011346264.1.60785 WP_011346264.1.89212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]