SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011346778.1.21303 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011346778.1.21303
Domain Number 1 Region: 29-146
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.94e-36
Family Thioltransferase 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011346778.1.21303
Sequence length 148
Comment MULTISPECIES: thiol reductase thioredoxin [Xanthomonas]; AA=GCF_001008905.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=681; AL=Scaffold; RT=Major
Sequence
MTDAPLLIACPSCAAMNRIAPTRLRDAPNCGSCHRPLFLGTPVALSAADFDKHAVRSALP
LVVDFWAPWCGPCLSMAPKFAAAAAALEPQVRLAKVDTDLHPALGTRFGIRSIPTLLVIQ
GGQELGRHSGAVSSAQIVNWVRSVLSKR
Download sequence
Identical sequences Q3BW05
316273.XCV1327 gi|78046883|ref|YP_363058.1| WP_011346778.1.100156 WP_011346778.1.10442 WP_011346778.1.11230 WP_011346778.1.13735 WP_011346778.1.199 WP_011346778.1.21303 WP_011346778.1.21317 WP_011346778.1.2259 WP_011346778.1.23534 WP_011346778.1.27112 WP_011346778.1.29361 WP_011346778.1.3003 WP_011346778.1.37942 WP_011346778.1.39371 WP_011346778.1.40690 WP_011346778.1.43396 WP_011346778.1.44794 WP_011346778.1.46449 WP_011346778.1.46677 WP_011346778.1.49886 WP_011346778.1.55770 WP_011346778.1.57452 WP_011346778.1.60785 WP_011346778.1.64411 WP_011346778.1.66420 WP_011346778.1.67180 WP_011346778.1.67877 WP_011346778.1.75734 WP_011346778.1.772 WP_011346778.1.79359 WP_011346778.1.81489 WP_011346778.1.8544 WP_011346778.1.89212 WP_011346778.1.89360 WP_011346778.1.94946 WP_011346778.1.99285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]