SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011346902.1.23534 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011346902.1.23534
Domain Number 1 Region: 1-115
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.47e-29
Family ArsC-like 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011346902.1.23534
Sequence length 118
Comment arsenate reductase [Xanthomonas euvesicatoria]; AA=GCF_001008885.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=586; AL=Scaffold; RT=Major
Sequence
MTTLYGLKNCDTCKKAAKWLDRVGVAYTFVDYRDHKPEPETLAAWAQQVGGFDVLINKSS
TTWRQLPDNRKAAGSAAEWKLLLREYPQLIRRPLVITDEGALHQGFSDNGFKKLFGVG
Download sequence
Identical sequences Q3BVJ4
WP_011346902.1.100156 WP_011346902.1.10442 WP_011346902.1.11230 WP_011346902.1.13735 WP_011346902.1.199 WP_011346902.1.21303 WP_011346902.1.21317 WP_011346902.1.2259 WP_011346902.1.23534 WP_011346902.1.27112 WP_011346902.1.29361 WP_011346902.1.3003 WP_011346902.1.37942 WP_011346902.1.39371 WP_011346902.1.40690 WP_011346902.1.43396 WP_011346902.1.44794 WP_011346902.1.46677 WP_011346902.1.49886 WP_011346902.1.55770 WP_011346902.1.60785 WP_011346902.1.64411 WP_011346902.1.66420 WP_011346902.1.67180 WP_011346902.1.67877 WP_011346902.1.75734 WP_011346902.1.772 WP_011346902.1.79359 WP_011346902.1.81489 WP_011346902.1.8544 WP_011346902.1.89212 WP_011346902.1.89360 WP_011346902.1.94946 WP_011346902.1.99285 gi|78047044|ref|YP_363219.1| 316273.XCV1488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]