SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011347460.1.772 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011347460.1.772
Domain Number 1 Region: 193-490
Classification Level Classification E-value
Superfamily NHL repeat 1.2e-29
Family NHL repeat 0.0021
Further Details:      
 
Domain Number 2 Region: 33-157
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.66e-18
Family Glutathione peroxidase-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011347460.1.772
Sequence length 499
Comment hypothetical protein [Xanthomonas euvesicatoria]; AA=GCF_001009045.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=376; AL=Scaffold; RT=Major
Sequence
MAAGRHCRAPHRGQTHPRLIALGHNHRMNAQLTQELPEFPTWLNARPSTLQEHRGRALVL
AFVNASSVWCAERLAELAHWQARSPGRLQVIVVQVPRFDSERLPQRSLKQLRGHGVSAPI
LLDKDWETWRRFGIESWPTLVLLDAYGRERQRLVGVTGDLDKALTALCEGQQPPSDADLH
GVAEREPEPHLALRFPTGLAATEDRLYVADTGHHRVLECTHSGRVLRQFGHGNADFIDGG
VGEAAFRRPQGLALERDQLYVADTGNHALRRINLRSGQVDTLCGTGRSGEPVEGPLASPG
ASALNYPQGLAIADNQVLIAMAGDNRIWSYHLGRAALTARAGTGALEIRDGSGHLAAFAQ
PAGLASVQQVAYVCDGLGSSIRTMQLRGDLVQTLVGGQGTWQFGDQDGPRSTARLQFPQA
IALAADSPLLWIADTGNGRLRCLRLGGGELTTVALPRRLHGPAGLAVTAGAVWIAETDAH
AILRYDLASGALSDVSIDE
Download sequence
Identical sequences Q3BTC4
WP_011347460.1.100156 WP_011347460.1.10442 WP_011347460.1.11230 WP_011347460.1.13735 WP_011347460.1.199 WP_011347460.1.21303 WP_011347460.1.2259 WP_011347460.1.23534 WP_011347460.1.27112 WP_011347460.1.3003 WP_011347460.1.37942 WP_011347460.1.39371 WP_011347460.1.40690 WP_011347460.1.43396 WP_011347460.1.44794 WP_011347460.1.46449 WP_011347460.1.46677 WP_011347460.1.49886 WP_011347460.1.51091 WP_011347460.1.55770 WP_011347460.1.60785 WP_011347460.1.64411 WP_011347460.1.66420 WP_011347460.1.67180 WP_011347460.1.67877 WP_011347460.1.75734 WP_011347460.1.772 WP_011347460.1.79359 WP_011347460.1.81489 WP_011347460.1.8544 WP_011347460.1.89212 WP_011347460.1.89360 WP_011347460.1.94946 WP_011347460.1.99285 gi|78047814|ref|YP_363989.1| 316273.XCV2258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]