SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011347512.1.48997 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011347512.1.48997
Domain Number 1 Region: 28-191
Classification Level Classification E-value
Superfamily Thioredoxin-like 4.55e-33
Family DsbA-like 0.0021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011347512.1.48997
Sequence length 214
Comment MULTISPECIES: DSBA oxidoreductase [Proteobacteria]; AA=GCF_001993645.1; RF=na; TAX=95486; STAX=95486; NAME=Burkholderia cenocepacia; strain=VC6456; AL=Contig; RT=Major
Sequence
MKRRHFLIAAAMVPLAPLANSVSAQEAFKAGKDFLELDKPVPVDAPPGKVEVIEFFSYNC
PHCAAFEPQLEIWTRQLPSIASFRRVPVPFVGSDVEAKQRMYYALQALGKEDEFRPRIFR
AIHQEHQRLFGDDAILAWADKQPGLDGKKFAEAYHSFSTMTRAKRATQTTSDFKVAGVPA
LGIAGRWYADGETAGSPERALQVTSFLIREASRA
Download sequence
Identical sequences A1W5Q6 Q3BT67
gi|78047871|ref|YP_364046.1| gi|121593761|ref|YP_985657.1| 232721.Ajs_1364 316273.XCV2315 WP_011347512.1.100156 WP_011347512.1.10851 WP_011347512.1.1166 WP_011347512.1.15547 WP_011347512.1.22175 WP_011347512.1.22218 WP_011347512.1.25034 WP_011347512.1.32398 WP_011347512.1.36423 WP_011347512.1.39107 WP_011347512.1.39276 WP_011347512.1.46677 WP_011347512.1.46794 WP_011347512.1.48997 WP_011347512.1.50840 WP_011347512.1.51974 WP_011347512.1.55042 WP_011347512.1.57447 WP_011347512.1.5773 WP_011347512.1.59344 WP_011347512.1.59475 WP_011347512.1.63472 WP_011347512.1.68100 WP_011347512.1.71282 WP_011347512.1.75714 WP_011347512.1.75887 WP_011347512.1.77749 WP_011347512.1.78085 WP_011347512.1.78834 WP_011347512.1.79438 WP_011347512.1.83765 WP_011347512.1.85154 WP_011347512.1.85744 WP_011347512.1.86513 WP_011347512.1.87490 WP_011347512.1.88184 WP_011347512.1.88381 WP_011347512.1.88916 WP_011347512.1.89212 WP_011347512.1.89316 WP_011347512.1.90836 WP_011347512.1.90933 WP_011347512.1.91074 WP_011347512.1.92898 WP_011347512.1.92934 WP_011347512.1.98528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]