SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348006.1.89212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348006.1.89212
Domain Number 1 Region: 6-111
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.16e-34
Family Thioltransferase 0.0023
Further Details:      
 
Weak hits

Sequence:  WP_011348006.1.89212
Domain Number - Region: 137-187,222-261
Classification Level Classification E-value
Superfamily TPR-like 0.000531
Family Tetratricopeptide repeat (TPR) 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011348006.1.89212
Sequence length 285
Comment co-chaperone YbbN [Xanthomonas euvesicatoria]; AA=GCF_001008815.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=206; AL=Scaffold; RT=Major
Sequence
MSDKPHVFDATTDTFETEVLQKSLTTPVLVDFWATWCGPCKSLTPILEKLAGEYNGAFEL
GKVDVDKEQQIAAAFQIRSVPTVFLVKGGEIVDGFPGAMPEGQVREFLTQHGVLPAEPQV
AEDVPPAPLDPQAQAAALREAVAAEPDKDELKLDLALALLKTGDTAEAEQLIDALPANLA
TDDRAVCAKARLSFANVLKDAPDAGTPQAAVDANSADLRARHLLGVRHLLDGNDEAALEQ
FLEMLRQDRSFDDNLPRRSLIDAFRVIQDEDLVGRYRRKMSALVF
Download sequence
Identical sequences Q3BRE2
316273.XCV2940 gi|78048496|ref|YP_364671.1| WP_011348006.1.100156 WP_011348006.1.331 WP_011348006.1.46449 WP_011348006.1.46677 WP_011348006.1.60785 WP_011348006.1.89212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]