SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348190.1.89360 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348190.1.89360
Domain Number 1 Region: 864-1041
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 2.88e-45
Family Histidine kinase 0.00068
Further Details:      
 
Domain Number 2 Region: 1060-1177
Classification Level Classification E-value
Superfamily CheY-like 2.7e-28
Family CheY-related 0.011
Further Details:      
 
Domain Number 3 Region: 798-876
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 1.86e-17
Family Homodimeric domain of signal transducing histidine kinase 0.0026
Further Details:      
 
Domain Number 4 Region: 405-608
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00000000000438
Family Serum paraoxonase/arylesterase 1, PON1 0.08
Further Details:      
 
Domain Number 5 Region: 38-278
Classification Level Classification E-value
Superfamily NHL repeat 0.00000000034
Family NHL repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011348190.1.89360
Sequence length 1191
Comment hybrid sensor histidine kinase/response regulator [Xanthomonas euvesicatoria]; AA=GCF_001008895.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=679; AL=Scaffold; RT=Major
Sequence
MRVLIVVLAVLLAIWPCAAKIPEVPRFRIVGPSEGLPSTMVVAISQDRAGYLWLGTLDGL
VRYDGAGFRTWRHDPADPGSLPCNAVQALHIDALDRVWVGCGKTLSVLDAGRRRFVHYRA
ADYPLLKDGEIFSIAAFDGGIWAGTTTGALVRIGADGGMSSVNLGGIEGALDHAMVMNLA
VDNQHRLWIGTSNGLAYYDGTQLHRQYVADEPNREAAIFGLQWAGDRLWLGSESGLHVLR
ADGRWQPLAWSTMFGNGNEFWGAVATPDGEFWLGSGRGLWRTRGERPPVPALSGEGPLSR
RNVIGLMGAADGGLWVPMHGTGLGYLPADWKRSAVLKPAVPMGDAIYCNLAPAKRSGGLW
QVDAQGRLLRVDPSTGDSFQTGLQSPQLKGMELVSALEDRLQRVWLGNLTFGLSRMDLRT
GDFVHWPSDGPEPSSALSAPEWIMEHGDTVWMAFIDMVQQRDLRTGKVLQRMTQQGLHGL
RAIDIQQLDQGPDGRVWVAGEGGMFAWDDATSRFVPVAGLEGTPIQAFASQSADTLWVYR
ASGAEQWQKRAAGWKRVRQVGEADGLSGFDASAMQIDPRGRVWISSLRGLWRIDPSVHPA
RVRNIGTRDGLTSQEFIQHCLLTSGDTLIGATSDGSTVLLDTAMPDVAPFVPALQLEHVS
VLRNGARIALPMDRPFQLGPEDRQLQIVSRLLSYSDPLSNRYRSFLKGFDTDWQTIGNTG
IREFASLPAGNYALALQGIDPLGNRSQVRSLQFSVRPPWWRSEIGIAAIGFSGLLLSALL
AAAYRRRIRMRAQWQLAQHKRELAEQASLAKTRFLATLGHEVRTPMTGVLGMSELLLQTP
LDGRQQGYASAIQLAGKHLLRLVNDALDLARIEAGKLPLDYRDFDLRQLVGQVVELVRPS
AEQKQLAFQCELDEALPPALHGDASRVQQILLNLLFNAVKFTERGSVHLRLTTLPQYTRQ
GLRVEVRDTGPGMSAEQRGRLFQRFEQAEGALTLARHGGSGLGLAICRELAAAMGGAVTV
TSELGQGACFVVELPLHWVSTLPAVTLPAVRAPSLREQAPLQLLLVEDDATVAQVIVGLL
QTRGHHVTHVLHGLAALAEVSTRSFDAGLCDLDLPGLDGAALVAQLRARGVRFPIVAVTA
RADTDAEPQAMAAGCNGFLRKPVTGDLLAQALARVLADVDDGQRDREAGDA
Download sequence
Identical sequences Q3BQR4
WP_011348190.1.100156 WP_011348190.1.10442 WP_011348190.1.11230 WP_011348190.1.13735 WP_011348190.1.21303 WP_011348190.1.21317 WP_011348190.1.2259 WP_011348190.1.23534 WP_011348190.1.29361 WP_011348190.1.3003 WP_011348190.1.37942 WP_011348190.1.39371 WP_011348190.1.40690 WP_011348190.1.43396 WP_011348190.1.44794 WP_011348190.1.46449 WP_011348190.1.46677 WP_011348190.1.49886 WP_011348190.1.55770 WP_011348190.1.60785 WP_011348190.1.64411 WP_011348190.1.66420 WP_011348190.1.67180 WP_011348190.1.67877 WP_011348190.1.75734 WP_011348190.1.772 WP_011348190.1.79359 WP_011348190.1.81489 WP_011348190.1.8544 WP_011348190.1.89212 WP_011348190.1.89360 WP_011348190.1.94946 gi|78048724|ref|YP_364899.1| 316273.XCV3168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]