SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348274.1.37942 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348274.1.37942
Domain Number 1 Region: 25-61,89-178
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.00000000314
Family SMI1/KNR4-like 0.012
Further Details:      
 
Domain Number 2 Region: 218-263,311-366
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 0.000000101
Family SMI1/KNR4-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011348274.1.37942
Sequence length 372
Comment MULTISPECIES: glucan biosynthesis protein [Xanthomonas]; AA=GCF_001009095.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=683; AL=Scaffold; RT=Major
Sequence
MAALKWMVYGRSPSLDTFWDDALNLGRVPATEAAIAAAQARLGVRLPAWLRELYARYDGG
AVQMARGQSLEEPDNWLKAEWLFPRARLLGSAELFSFAQVRAREEYRDDAFAGLAAGGDD
RHLIVIAADDRSPSRALCLDYSAFGAEPTLVYVDAGDKRRLAVFANVEDLLAQLVDVHYW
SPALQAKHDADVVQWQPQPPALTTFWSGADGRNDGGAAADADAFAEAEARLGVRLPALFK
RLYSVQDGGDTGWCWVPRTRFPSDHYVDWECVLVDRDLSPLAQIRSVLDFADAFEDRSDF
RAAACLHAGLDQVLVLSCHNVDSLLCLDYRARGPQCEPEVVYFENWEGLVPTWRAARFDA
FFAVLRQAELDV
Download sequence
Identical sequences A0A0G8WME8 A0A1S1XH77 Q3BQF4
316273.XCV3278 WP_011348274.1.100156 WP_011348274.1.100312 WP_011348274.1.10442 WP_011348274.1.11230 WP_011348274.1.12827 WP_011348274.1.13735 WP_011348274.1.14159 WP_011348274.1.16263 WP_011348274.1.17112 WP_011348274.1.19776 WP_011348274.1.199 WP_011348274.1.20169 WP_011348274.1.21303 WP_011348274.1.21317 WP_011348274.1.2259 WP_011348274.1.23534 WP_011348274.1.24172 WP_011348274.1.25231 WP_011348274.1.27112 WP_011348274.1.29361 WP_011348274.1.3003 WP_011348274.1.30677 WP_011348274.1.331 WP_011348274.1.3440 WP_011348274.1.37569 WP_011348274.1.37942 WP_011348274.1.39371 WP_011348274.1.40690 WP_011348274.1.43396 WP_011348274.1.43419 WP_011348274.1.44794 WP_011348274.1.46449 WP_011348274.1.46677 WP_011348274.1.47244 WP_011348274.1.47958 WP_011348274.1.48351 WP_011348274.1.49886 WP_011348274.1.50405 WP_011348274.1.51091 WP_011348274.1.5224 WP_011348274.1.54158 WP_011348274.1.54709 WP_011348274.1.55770 WP_011348274.1.56262 WP_011348274.1.57452 WP_011348274.1.59767 WP_011348274.1.60785 WP_011348274.1.61221 WP_011348274.1.64411 WP_011348274.1.656 WP_011348274.1.66420 WP_011348274.1.67180 WP_011348274.1.67877 WP_011348274.1.6838 WP_011348274.1.68402 WP_011348274.1.72305 WP_011348274.1.772 WP_011348274.1.77810 WP_011348274.1.78066 WP_011348274.1.79359 WP_011348274.1.79878 WP_011348274.1.80975 WP_011348274.1.81489 WP_011348274.1.85024 WP_011348274.1.85152 WP_011348274.1.8544 WP_011348274.1.86099 WP_011348274.1.89212 WP_011348274.1.94781 WP_011348274.1.94946 WP_011348274.1.96073 WP_011348274.1.9928 WP_011348274.1.99285 gi|78048834|ref|YP_365009.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]