SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348560.1.67877 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348560.1.67877
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.23e-36
Family ArsC-like 0.000027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011348560.1.67877
Sequence length 140
Comment MULTISPECIES: arsenate reductase (glutaredoxin) [Xanthomonas]; AA=GCF_001691345.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=LMG 909; AL=Contig; RT=Major
Sequence
MHAVIYHNPGCGTSRNTLALIRHTGIEPQIVDYLQHPPSRQTLQALIAAAGITVRQAMRQ
KGTPYLELGLDDPTLDDAALLSAMLAHPILINRPFVQTTRGTRLCRPSELVLDLLPPATH
GFIKEDGERVLDEAGQRIGR
Download sequence
Identical sequences G2LTF8 Q3BPE5
gi|78049193|ref|YP_365368.1| WP_011348560.1.100156 WP_011348560.1.10442 WP_011348560.1.11230 WP_011348560.1.13735 WP_011348560.1.199 WP_011348560.1.21303 WP_011348560.1.21317 WP_011348560.1.2230 WP_011348560.1.2259 WP_011348560.1.23534 WP_011348560.1.27112 WP_011348560.1.29361 WP_011348560.1.3003 WP_011348560.1.37942 WP_011348560.1.39371 WP_011348560.1.40690 WP_011348560.1.43396 WP_011348560.1.44794 WP_011348560.1.46449 WP_011348560.1.46677 WP_011348560.1.49886 WP_011348560.1.51091 WP_011348560.1.55770 WP_011348560.1.60785 WP_011348560.1.64411 WP_011348560.1.66420 WP_011348560.1.67180 WP_011348560.1.67877 WP_011348560.1.68402 WP_011348560.1.75734 WP_011348560.1.772 WP_011348560.1.79359 WP_011348560.1.81489 WP_011348560.1.8544 WP_011348560.1.89212 WP_011348560.1.89360 WP_011348560.1.94946 WP_011348560.1.99285 316273.XCV3637 gi|346726282|ref|YP_004852951.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]