SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348589.1.199 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348589.1.199
Domain Number 1 Region: 114-255
Classification Level Classification E-value
Superfamily Thioredoxin-like 7.88e-37
Family DsbC/DsbG C-terminal domain-like 0.000057
Further Details:      
 
Domain Number 2 Region: 55-102
Classification Level Classification E-value
Superfamily DsbC/DsbG N-terminal domain-like 0.000000000126
Family DsbC/DsbG N-terminal domain-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011348589.1.199
Sequence length 265
Comment hypothetical protein [Xanthomonas euvesicatoria]; AA=GCF_001010095.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=181; AL=Scaffold; RT=Major
Sequence
MYRLAIAALLGAISLTACAQSSQPAASTAGAKPAAAPAATGTVDQRVSTALKALDPDFKP
DYIGAAPFPGFREVVVGGQVLYLSDDGRYLIQAQPFDIQNKQFAASPGLLAYRRKQLDTV
PKADRIVFAPANPKYTVTVFTDVECGYCRKLHSEIGELNKQGIAVEYLAFPRMGLGSQDH
KEMIAVWCAADRKQALTAAKSGQPVASKDCKNPVSMEYNLGQRLGVNGTPAIFAPDGTQL
GGYLPPAQLREALEKRAVSTAGGSR
Download sequence
Identical sequences Q3BPA7
WP_011348589.1.100156 WP_011348589.1.10442 WP_011348589.1.11230 WP_011348589.1.13735 WP_011348589.1.199 WP_011348589.1.21303 WP_011348589.1.21317 WP_011348589.1.2259 WP_011348589.1.23534 WP_011348589.1.27112 WP_011348589.1.29361 WP_011348589.1.3003 WP_011348589.1.37942 WP_011348589.1.39371 WP_011348589.1.40690 WP_011348589.1.43396 WP_011348589.1.44794 WP_011348589.1.46677 WP_011348589.1.49886 WP_011348589.1.55770 WP_011348589.1.60785 WP_011348589.1.64411 WP_011348589.1.66420 WP_011348589.1.67180 WP_011348589.1.67877 WP_011348589.1.75734 WP_011348589.1.772 WP_011348589.1.79359 WP_011348589.1.81489 WP_011348589.1.8544 WP_011348589.1.89212 WP_011348589.1.89360 WP_011348589.1.94946 WP_011348589.1.99285 316273.XCV3675 gi|78049231|ref|YP_365406.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]