SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011348836.1.89212 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011348836.1.89212
Domain Number 1 Region: 33-161
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.3e-22
Family Thioltransferase 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011348836.1.89212
Sequence length 526
Comment thiol reductase thioredoxin [Xanthomonas euvesicatoria]; AA=GCF_001008815.1; RF=na; TAX=456327; STAX=456327; NAME=Xanthomonas euvesicatoria; strain=206; AL=Scaffold; RT=Major
Sequence
MTLSLPRPSPSLIALLAVLAALTACDKPAPPAAPAPPKTASTPAPVAGIAWREGDVEDAF
AEAKDSGKPILLYWGAAWCPPCNRLKATLFKDPAFIARTQQFVAVHLDGDSEGAQAWGER
FGVKAYPTIIVLRPDRREITRLAGNADNARLAEVLRVAAKSTSTAQQLLDKALHTPQQLS
ADDWAVLGNYAWGTDDTLVKPDAAADVLTRLSTSAPQPALQRSFALAAISAARHPPAASS
ANRTLLEAVLADPAEVRANLGTLNYVPARLVTAASNEAGERSTLSNALNQALDKVYADPS
LPISDRLGTAYARIQLARLAQGQPTETEAEGPQPPLPKDVVEVVHQRVQWATDTAKTDEE
RQSTISMAAALLSEVGDRSAAEQLLLAELSRSKTPYYYMPELADLAEQRGDKKTALLWLK
RAYDSAQGPATRVQWGVMYVDGLIRLSPDDSAGIEGAATQVIGELAGQPDGYRQRTRQRF
ATLGTALKTWSKQHRREGSAVLARLQQKMQSSCDSKATSECASWLS
Download sequence
Identical sequences Q3BND6
gi|78049552|ref|YP_365727.1| WP_011348836.1.100156 WP_011348836.1.10442 WP_011348836.1.11230 WP_011348836.1.13735 WP_011348836.1.199 WP_011348836.1.21303 WP_011348836.1.21317 WP_011348836.1.2259 WP_011348836.1.23534 WP_011348836.1.27112 WP_011348836.1.29361 WP_011348836.1.3003 WP_011348836.1.37942 WP_011348836.1.39371 WP_011348836.1.43396 WP_011348836.1.44794 WP_011348836.1.46449 WP_011348836.1.46677 WP_011348836.1.49886 WP_011348836.1.55770 WP_011348836.1.60785 WP_011348836.1.64411 WP_011348836.1.66420 WP_011348836.1.67180 WP_011348836.1.67877 WP_011348836.1.75734 WP_011348836.1.772 WP_011348836.1.79359 WP_011348836.1.81489 WP_011348836.1.8544 WP_011348836.1.89212 WP_011348836.1.89360 WP_011348836.1.94946 WP_011348836.1.99285 316273.XCV3996

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]