SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011377880.1.45845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011377880.1.45845
Domain Number 1 Region: 3-161,242-254,382-445
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 3.27e-22
Family FAD/NAD-linked reductases, N-terminal and central domains 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011377880.1.45845
Sequence length 585
Comment MULTISPECIES: hypothetical protein [Synechococcus]; AA=GCF_000817325.1; RF=na; TAX=1350461; STAX=1350461; NAME=Synechococcus sp. UTEX 2973; strain=UTEX 2973; AL=Complete Genome; RT=Major
Sequence
MLETLRTDVLIVGGGTGGTAAALQAARRGAQTILVSEGPWLGGMLTSAGVSAPDGNELRA
LQTGIWGAFLKALRQRQPDGLNHAWVSFFTYDPRVGSQIFADWVRELPNLKWIQGDRPRA
VIGDRDRLRGVEFERVRIEAQVVIDATELGDLLALADVPHRWGWEPQEEWQEPSAPTLAQ
LESDDRYQRYPVQSPTWVVVMADQSQSAPPIPASTSYNPDLFAGAWQTPDNLAFLDYGRL
PGDRFMINWPGPGNDYGEGLQRLIQGDRAHQEWMQEAIAHSQAFAHHIQAHWSDRYGLAR
DQFPQQAIGGGAFALQPYYRESRRVVGSSTITELDLLPLHQGQVAKLPCNASGQVSAIAI
GNYANDHHYPNWDFRLQPKSMRWGGRWTGTAFSLPYDCLLPVQTEGLLVCEKNIAVSHIA
NGATRLQPVVLGLGQAAGMAAALAVEQNCDPRSLSVRDLQEALLTDSEAPQAIVPLYDTP
PEHPDWLTRQRAYLDRPEAYPATGVHGGTAAASLISARAQTVSGQFERLGDQNYQLDDGK
TVWQLVTLDASIDQQFKALSDRLPLAVVGLINPAGHWLIVEAIHP
Download sequence
Identical sequences Q31P49
WP_011377880.1.45845 WP_011377880.1.95485 1140.Synpcc7942_1140 gi|81299949|ref|YP_400157.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]