SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011377967.1.5740 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011377967.1.5740
Domain Number 1 Region: 17-304
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.1e-54
Family Protein kinases, catalytic subunit 0.00014
Further Details:      
 
Domain Number 2 Region: 396-514
Classification Level Classification E-value
Superfamily Pentapeptide repeat-like 3.79e-31
Family Pentapeptide repeats 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011377967.1.5740
Sequence length 522
Comment MULTISPECIES: serine/threonine protein kinase [Synechococcus]; AA=GCF_000010065.1; RF=representative genome; TAX=269084; STAX=32046; NAME=Synechococcus elongatus PCC 6301; strain=PCC 6301; AL=Complete Genome; RT=Major
Sequence
MALCLNPDCGQPNNDDANSSCATCGSPLLLRDRYRVVKAIGQGGFGATYLGQDLQLPGEP
LCVIKQLLPQVQDPEIMLMARELFRREAKTLGRIGSHPQVPTLLDYFEAPEGFYLVQEYI
RGKTLEQEVREQGVYSETATKQFLSELLPLLQYLHNQGVIHRDIKPANLLRRDIDRRLVL
IDFGAVKDQVSQIQGGSGLTALTSFSVGTRGYAPPEQLAMRPVYSSDLYSLGVTCLFLMT
GKGPQDLDYNPVTGELLWRNSVQVSDALATVLGKMLAASVRYRYQRAEQVMTALDLQPYH
DSLIQGLSALPPGAPPIKPSSGRTGSGYPSPQERQAEAIRARRRDRSGNRPEQLADAQQI
AAWTGGTSNTSGNNSAGRLSLNARDILATYQRGRRDFSQQPLNRIDLSESQLPSVNFQGA
QLKESLFVAAQLERADFGQANLHRANLRRANLHQAYFGNADLSFANLQKADLSDAILSNA
NLRGTNLCGANLRGAKLTPVQLKMAKTNWWTILPDGRRGRLF
Download sequence
Identical sequences Q31NP5
WP_011377967.1.45845 WP_011377967.1.5740 WP_011377967.1.95485 gi|81300103|ref|YP_400311.1| NYSGRC-FDAO-ABB57324 SnR201 1140.Synpcc7942_1294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]