SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011378256.1.95485 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011378256.1.95485
Domain Number 1 Region: 346-536
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 1.7e-50
Family Ppx associated domain 0.002
Further Details:      
 
Domain Number 2 Region: 151-332
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.08e-43
Family Ppx/GppA phosphatase 0.00081
Further Details:      
 
Domain Number 3 Region: 23-146
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 7.45e-35
Family Ppx/GppA phosphatase 0.00091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011378256.1.95485
Sequence length 549
Comment MULTISPECIES: exopolyphosphatase [Synechococcus]; AA=GCF_000012525.1; RF=na; TAX=1140; STAX=32046; NAME=Synechococcus elongatus PCC 7942; strain=PCC 7942; AL=Complete Genome; RT=Major
Sequence
MSTEIAPHARPALPSELGPEPILAAIDVGTNSIHMVVVQIRPDLPAFDIVGTEKATVRLG
DRDPATGELTEAAMERALQALQRCRAIAAARGATQIVAVATSAVREAPNGRQFLERVIHE
VGLEVDLISGPEEARRIYLGVLSGMDFQQRHHAIIDIGGGSTELILGAGQEPLCLTSTKV
GAVRLTQEFIHTDPISPSEYTVLQAYVRGMVERAVDEVKAALPPNTPLRLIGTSGTIQAL
AALHAHQSQGSLPTTFNGYSLALGDLQQLVQQLRRMPFAERQTLPELSERRAEIIVAGAI
VLQETMQLLGCDRVTICERALREGLIVDWMLSHGLIEDKLRYQGSVRQRSVYNQARKFRV
DVSHGEQVAQLALSLFDQLRGQLHQWGESERELLWAAAILHNCGHHIDHSSHHKHSYYLI
RHGGLLGYNETEIELIANLARYHRKSLPKKKHENFRTLPTKEQRRLVEQLSAILRAAVAL
DRRQVGAIASLHCRYLAPQRQLLLQLHPARTSEDCALELWSFDYNRHALEAAFAINVAAE
LVPQPLSAV
Download sequence
Identical sequences Q31LS4
gi|81300774|ref|YP_400982.1| 1140.Synpcc7942_1965 WP_011378256.1.45845 WP_011378256.1.5740 WP_011378256.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]