SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011378309.1.45845 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011378309.1.45845
Domain Number 1 Region: 1-254
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.33e-82
Family Histidine biosynthesis enzymes 0.0000000982
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011378309.1.45845
Sequence length 255
Comment MULTISPECIES: imidazole glycerol phosphate synthase cyclase subunit [Synechococcus]; AA=GCF_000817325.1; RF=na; TAX=1350461; STAX=1350461; NAME=Synechococcus sp. UTEX 2973; strain=UTEX 2973; AL=Complete Genome; RT=Major
Sequence
MLAKRILPCLDVKAGRVVKGVNFVDLRDAGDPVELAQAYDAAGADELVFLDIAATHEERQ
ILVDVVYRTAEQVFIPLTVGGGINDLETIRQLLRAGADKVSINSAAVRDPDLIRRASDRF
GSQCIVVAIDARRRTDPDNPGWDVYVRGGRENTGIDALTWAETVARNGAGELLVTSMDAD
GTQAGYDLELTRAIADRVEIPVIASGGAGTCEDIAEAFRTGHAEAALLASLLHYGQLTIA
EIKDHLRSAQIPTRP
Download sequence
Identical sequences Q31LF2
1140.Synpcc7942_2087 gi|81300896|ref|YP_401104.1| WP_011378309.1.45845 WP_011378309.1.95485

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]