SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011418758.1.90099 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011418758.1.90099
Domain Number 1 Region: 341-395
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000383
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011418758.1.90099
Sequence length 769
Comment hypothetical protein [Syntrophus aciditrophicus]; AA=GCF_000013405.1; RF=representative genome; TAX=56780; STAX=316277; NAME=Syntrophus aciditrophicus SB; strain=SB; AL=Complete Genome; RT=Major
Sequence
MKKSDTSHQMPMLSVIPTQIILLWIAFLIMIILPTPIQADMGRVVATEAQVSEDSQKAII
LHNREEEVLILGTDLKADKSARIIRFIPFPEEPKVQLASPASFESAMDLIKKHGLKFIEQ
TKGGRAAARAVEMRFNQRLGSHDVTVIRINDAAEFNGWVREFLRQKGLQLKREDPKIEAV
VRDYTRRGFVWFVFDFVTVNEQIRFVEPIQYRFKTKELYYPLKTSNTFGGSGMIDLILIT
PGTFCEPLQSYYGGCFGFQEMRATTSSQLENDEMKGIFPGIGQFSKNQNMFIQLMRYQGD
YEFDQDLLGDFGQAVPYAIGHVEEAWGSPWLFPMEENVKDLKERCRLKPDSGPCKAIFWR
YFFNPETQKCEKFVYGGCEGTVPFETKEECVALCEKDGGASSTLKNINFEEFTPSSKHFT
LQIPAGWPREEYDIQRSSLLSGNNKYELTVRAPGQEGLEYLSVRVAWHRDACGTPERFIY
DLLNPRFSSRRADAKVLPLTGPEAKTLEIKKVRQPFQGMNAKPVKAIERYVVIPAHTGFY
VLVYDAPEALFKENKWVFDKILSSFQPMVSLNSKPEPVAEVSDDEYEVYADFFSAEEVRG
FEIPPYFSNTYRARHVYHETSAGKNSDKQTLTHLMESFGALDKSIMEDYREKNKRVRILR
DRMVVPWLEILQTNEPNREGGRGMEQPLTVFPDEVFLSRIGFNEQKDTALFYVSQNGAPM
TGYFVLMVKKKNRWVIKNAVLEDFKIPYSEISPSFQYIQHDISDGKGGR
Download sequence
Identical sequences Q2LXC8
56780.SYN_02414 gi|85860708|ref|YP_462910.1| WP_011418758.1.90099

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]