SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011445534.1.96002 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011445534.1.96002
Domain Number 1 Region: 1-307
Classification Level Classification E-value
Superfamily Arabinanase/levansucrase/invertase 4.08e-86
Family Glycosyl hydrolases family 32 N-terminal domain 0.000000616
Further Details:      
 
Weak hits

Sequence:  WP_011445534.1.96002
Domain Number - Region: 345-417
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.00135
Family Glycosyl hydrolases family 32 C-terminal domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011445534.1.96002
Sequence length 440
Comment glycoside hydrolase [Novosphingobium aromaticivorans]; AA=GCF_000013325.1; RF=representative genome; TAX=279238; STAX=48935; NAME=Novosphingobium aromaticivorans DSM 12444; strain=DSM 12444; AL=Complete Genome; RT=Major
Sequence
MRPLYHYAPAANWLSDPNGLVWQDGEWHLFYQYNPFGEDWGHMSWGHAVSRDLVTWQELP
VALAEEDGTMIFSGSAVIDHQGSAGFGKGAMVAVYTGARTDRAHQFQSIAASTDRGRTFT
KFTGNPVLDLQMADFRDPNVFWHGPSGRWIMSVVLSEENRAQLYASVDLRHWDLLSDIGR
DGAPGHLWECPWMVELPVEGTDETRWLFKVDVLSGAAGQASPWRVGHFDGRRFVPETGWA
VGDHGPDFYAAIGWNAAPDAEGRPVWIGWAGNHAYQKYLEPQGWRGAMTLPRRVSLRRDE
SGYALVQEVEPACRALFGKAEATSLCDGCIPLPSAALLSFPAGKDWSFRIEDDHGRSIEC
ALSGGRLTVRRHDPVTPQLEHRAAMEAGKGPVELWLDAGSLEVFANRGGAVLTLQHRLAG
EAWALRGEGACSVAYPAAMA
Download sequence
Identical sequences Q2G749
279238.Saro_1884 gi|87199901|ref|YP_497158.1| WP_011445534.1.26809 WP_011445534.1.96002

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]