SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011447420.1.85653 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011447420.1.85653
Domain Number 1 Region: 3-102
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 6.45e-34
Family Canonical RBD 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011447420.1.85653
Sequence length 103
Comment RNA recognition motif-containing protein [Methanospirillum hungatei]; AA=GCF_000013445.1; RF=representative genome; TAX=323259; STAX=2203; NAME=Methanospirillum hungatei JF-1; strain=JF-1; AL=Complete Genome; RT=Major
Sequence
MEGKKLYVGNLPYSTNESQLSELFSSYGEVVSAKIIENKGFGFVEMGTSEEAQAALDALN
DTEFDGRTMRIDEARPMQPRRDFGGNRSGGFGGSSGGFNRRRF
Download sequence
Identical sequences A0A1V5SYC6 Q2FLA6
gi|88601667|ref|YP_501845.1| 323259.Mhun_0356 WP_011447420.1.85653

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]