SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011467135.1.82451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011467135.1.82451
Domain Number 1 Region: 326-569
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.99e-67
Family Glycosyl hydrolases family 16 0.0041
Further Details:      
 
Domain Number 2 Region: 180-315
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.04e-32
Family Family 6 carbohydrate binding module, CBM6 0.00011
Further Details:      
 
Domain Number 3 Region: 31-167
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4e-32
Family Family 6 carbohydrate binding module, CBM6 0.0000894
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011467135.1.82451
Sequence length 569
Comment beta-glucanase [Saccharophagus degradans]; AA=GCF_000013665.1; RF=representative genome; TAX=203122; STAX=86304; NAME=Saccharophagus degradans 2-40; strain=2-40; AL=Complete Genome; RT=Major
Sequence
MIKTCKTTPAKWAAALSLGCALLLPSGVNAATFQAEDYSAFYDTTAGNTGGAYRNDNVDI
EATNDNGGGYNVGWIDANEWLVYPGVNITTTGDYVINVRVASASGGALSVDFNAGSIPLG
QFDIPNTGGWQNWVTVSKTVTLTAGTYDMGVFASTGGWNFNWIEVTPVNNGGGNGGGSAT
FFQAEDYSNYSDTTPENIGGAYRNDGVDIETTSDANGGHNIGWMENGEWLAYEGLSIPSN
GNYIIKARVASPNGGALSFDLNGGGQVLGTMNIPATGGWQNWQTVELSTNINAGTYTLGA
FVSTSGFNLNWIEVVAGGDGGNNGGGGGNITWRDEFDTINRDVWNFETGGGGWGNNELQY
YTDGQNASIQFDPQAGSNVLVIEARKETGGQCWWGGNCGYTSSRMNTRFKKSFQYGRIEA
RMKLPRTQGIWPAFWMLGDNFNNVGWPQGGELDIMEHVGTNNITSGALHGPGYSGNTPIT
GHLEHGASIDSGYRVYAVEWDTNGIRWFVDGTNFYSVEKWQVQQYGEWVYDQPFWILLNL
AVGGNWPGDPDHANFTTQRFYIDYVRVIQ
Download sequence
Identical sequences Q21N15
203122.Sde_0652 WP_011467135.1.82451 gi|90020299|ref|YP_526126.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]