SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011470156.1.82451 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011470156.1.82451
Domain Number 1 Region: 10-155
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.58e-25
Family SMI1/KNR4-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011470156.1.82451
Sequence length 157
Comment SMI1/KNR4 family protein [Saccharophagus degradans]; AA=GCF_000013665.1; RF=representative genome; TAX=203122; STAX=86304; NAME=Saccharophagus degradans 2-40; strain=2-40; AL=Complete Genome; RT=Major
Sequence
MELEITPIAGAISESAIRDFEENIGMPFPPDYREFMLKYNGGDPLKCVFKFQNATGPYSD
SIIRYFFAFSDDYDESIKHNHEAYTLADRVPKNILPIAEDPGGNIVCLSLAGDDVGKVYF
WDHEQEGLTEASATYENLELIANSFTEFVDGLEEESY
Download sequence
Identical sequences Q21ED8
gi|90023326|ref|YP_529153.1| 203122.Sde_3686 WP_011470156.1.82451

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]