SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011470686.1.69038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011470686.1.69038
Domain Number 1 Region: 28-249
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.47e-73
Family Atu2684-like 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011470686.1.69038
Sequence length 251
Comment DUF1223 domain-containing protein [Rhodopseudomonas palustris]; AA=GCF_000013745.1; RF=representative genome; TAX=316056; STAX=1076; NAME=Rhodopseudomonas palustris BisB18; strain=BisB18; AL=Complete Genome; RT=Major
Sequence
MMAWSGLLNGPGALAACALLATICPAVAQPRAVVELFTSQGCSSCPAADKIIGDLASDPS
VIALSMPIDYWDYLGWKDTLADSRFSARQKAYSARRGDRDVYTPQMIVNGAMQVVGNDRA
RIDGAISDTEKTAGVMSVPVTVTLDGKQLKVAVAAGAADVAPSQAEVWICSISKAVPIAI
TRGENRGREVTYHNVVRTWLKVGDWTGQADSWTVPIENVAGAGVDAAVVYVQSGSREQPG
PMLGAALTALD
Download sequence
Identical sequences Q21CV8
316056.RPC_0203 gi|90421727|ref|YP_530097.1| WP_011470686.1.69038

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]