SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011471098.1.69038 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011471098.1.69038
Domain Number 1 Region: 2-137
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.94e-41
Family ArsC-like 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011471098.1.69038
Sequence length 142
Comment arsenate reductase (glutaredoxin) [Rhodopseudomonas palustris]; AA=GCF_000013745.1; RF=representative genome; TAX=316056; STAX=1076; NAME=Rhodopseudomonas palustris BisB18; strain=BisB18; AL=Complete Genome; RT=Major
Sequence
MDVIIYHNPDCGTSRNTLALIRHAGIEPHVVEYLKTPPSRAMLQQLIARIGLGTRALLRE
KGTPYAELGLDSPALSDDELLDAMLAHPILINRPIVVSPRGVKLCRPSEEVLEILPPITA
GEFHKEDGELVIDASGRRVATA
Download sequence
Identical sequences Q21BP6
316056.RPC_0617 WP_011471098.1.69038 gi|90422139|ref|YP_530509.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]