SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011485888.1.11221 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011485888.1.11221
Domain Number 1 Region: 284-444,758-858
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-23
Family ABC transporter ATPase domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 17-158,204-260
Classification Level Classification E-value
Superfamily PHP domain-like 6.08e-20
Family PHP domain 0.011
Further Details:      
 
Weak hits

Sequence:  WP_011485888.1.11221
Domain Number - Region: 460-492
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.08
Family HLH, helix-loop-helix DNA-binding domain 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011485888.1.11221
Sequence length 894
Comment PHP-like [Polaromonas sp. JS666]; AA=GCF_000013865.1; RF=na; TAX=296591; STAX=296591; NAME=Polaromonas sp. JS666; strain=JS666; AL=Complete Genome; RT=Major
Sequence
MTGKLQECLTQSDGAHFYRGDLHIHSYRASHDVNDIGMTPQAIVDTVVRENLQIIAVADH
NEIGNVQATVLAGASARILVIPAVELSTPEGHLLCYFETVEALAQFHGRLNLADRGLSNS
RCRNAMYACLDLAKELGGFCVLAHVDGGNGLETNDPGGSPHKTDIICHAALLGIELSSAT
SPVRYAPDDSDQVRAHIGKQRIERLGLGERQYLARILSSDSHTLNALGRNASQDRKLTRY
KMATPSFDGLRHALEEGDSRIRLEDEVPTATPFILGATIGGGFLKGQSIHFSRNLNCIIG
GRGTGKSTTFEAVRCLTGSESGAEVVDSEVWPHQLHLFWQDEAGQQHSLSRAIGESLTNL
DDPLDGPIAFELDCFGQGEAARVREQAKGDPLALMKYLDTFTRVHDAIEDERVARNNLQA
QRLKIVDAEKNVAAIPQTQRSLTVVQQQLQAFEAAKGSDVIKLQRSLAMEKSKKEHLNEQ
LAELKDLVEDATLTETATAVRSLVDSGDIVTGRSEAAEIVLAVDEFSAKVRQAQDAIALA
YAQLQSATTGSIGRWTANERPIRDDIETKRIALEAQGIRLDMSHVAKLTAEEAKQQKSLT
ALKTWEPHLKTLRTQYSAMLSNRWQARRKVASLRQAYAIKASRALAEVLSDLQVKLQYVE
SGFAEEAVVIIATALSWRTVNHPKSRLIVEKLTVPGLLDAIAKSQTAPLTSIRVEEDVQQ
FSLAEAKEILDKLGDPSVRAALEQCHVDDLPRLTVTRRVNDGAGVSYMQRDFSQLSLGQQ
QSVLLALILSSDSKRPLIIDQPEDNLDSEFIFHTFVPVLRRAKERRQVIIVTHNANIAVL
GDAEQLIVFKSNSDHSRIVARGSIDDTAARDAACKILEGAREAFTRRAKIYGIT
Download sequence
Identical sequences Q120Y7
gi|91790852|ref|YP_551803.1|NC_007949 296591.Bpro_5033 gi|91790852|ref|YP_551803.1| WP_011485888.1.11221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]