SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011495196.1.19895 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011495196.1.19895
Domain Number 1 Region: 1-132
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 4.19e-42
Family SMI1/KNR4-like 0.00000567
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011495196.1.19895
Sequence length 133
Comment SMI1/KNR4 family protein [Shewanella denitrificans]; AA=GCF_000013765.1; RF=representative genome; TAX=318161; STAX=192073; NAME=Shewanella denitrificans OS217; strain=OS217; AL=Complete Genome; RT=Major
Sequence
MHELIEQLQALNEPVPVPLELASFEQLVEVEEQILISLPRELKVYLMEASDVVYGHIEPV
TASDPQSHTYLPEVTCYAWSIGLPRELIAICQQGDNFYCIDQDGQVHFWKNGRFVGEVFE
SFWHWVDRVWLNN
Download sequence
Identical sequences Q12R95
gi|91792103|ref|YP_561754.1| WP_011495196.1.19895 318161.Sden_0741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]