SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011500403.1.71292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011500403.1.71292
Domain Number 1 Region: 3-284
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 6.28e-147
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000000105
Further Details:      
 
Domain Number 2 Region: 285-571
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 3.92e-144
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000000221
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011500403.1.71292
Sequence length 572
Comment methyl-coenzyme M reductase subunit alpha [Methanococcoides burtonii]; AA=GCF_000013725.1; RF=representative genome; TAX=259564; STAX=29291; NAME=Methanococcoides burtonii DSM 6242; strain=DSM 6242; AL=Complete Genome; RT=Major
Sequence
MADDRKRMFQKDLEIKFTKAHGDNKMEGGEITDKKVTYYRLGVDQNPRKVEMRKAGQEIA
DKRGLVGYNPMMHCGGIPLGQRALTPSFISGTDIMVESDDLHYVNNAAMQQMWDDIRRTT
IVGMDMAHETLEKRLGIEVTPETINHYLEVLNHALPGGAVVQEHMVETHPALVDDCYCKI
FTGDDELADEIDDQFLININKQFPEEQAEALKAAIGKTTWQAAHIPTIVSRTTDGAQTSR
WMAMQVGMSFIAAYNMCAGEAAVADLSYAAKHAGVISMGDMLPARRARGPNEPGGISFGH
MADIIQTSRVDAEDPAHVALEVVGAGCMLYDQIWLGSYMSGGVGFTQYATAAYTNNILDD
NLYYNVDYINDKYDGAANKGADNKVKATMDVVKDIATESTIYGIENYEKYPTALEDHFGG
SQRATVLSAAAGSATALATGNGNAGLSGWYLSMYLHKEALGRLGFFGFDLQDQCGATNVF
SFQSDEGLPLELRGPNYPNYAMNVGHQGGYAAITSAAHAGRGDAWAVNPLIKVCFADDML
PFDFTAPRKEFGRGALKEFEPAGERSLIIPAK
Download sequence
Identical sequences Q12TF8
gi|91774326|ref|YP_567018.1| 259564.Mbur_2417 WP_011500403.1.71292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]