SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011515019.1.52493 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011515019.1.52493
Domain Number 1 Region: 27-195
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.97e-45
Family DsbA-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011515019.1.52493
Sequence length 212
Comment MULTISPECIES: DSBA oxidoreductase [Cupriavidus]; AA=GCF_000709045.1; RF=na; TAX=119219; STAX=119219; NAME=Cupriavidus metallidurans; strain=NA4; AL=Contig; RT=Major
Sequence
MKKIAALLATVAAVSGLLMTAPAAMAAPTEGKDYTVLKSPQPVPAGKIEVTEFFWYGCPH
CYDFEPELEAWVKKQGKDVVFKRVPVAFRDDLLPHTKIFYALEAMGKLDAMHTKVFDAIH
KQRKRLLTTDEIADFMAQNGIDKKQWLDTYNSFSVTTNSQRANKIADAYKIDGVPTVVVQ
GKYETSPSIAGTKPGAIQAMDFLVTGVRDKKL
Download sequence
Identical sequences A0A132HAZ1 A0A2A4M7A7 Q1LS92
gi|94309043|ref|YP_582253.1| WP_011515019.1.12480 WP_011515019.1.22474 WP_011515019.1.25839 WP_011515019.1.38154 WP_011515019.1.481 WP_011515019.1.52493 WP_011515019.1.66126 266264.Rmet_0098

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]