SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011515029.1.66126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011515029.1.66126
Domain Number 1 Region: 4-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.46e-42
Family DsbA-like 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011515029.1.66126
Sequence length 219
Comment 2-hydroxychromene-2-carboxylate isomerase [Cupriavidus metallidurans]; AA=GCF_001598775.1; RF=na; TAX=1218106; STAX=119219; NAME=Cupriavidus metallidurans NBRC 101272; strain=NBRC 101272; AL=Contig; RT=Major
Sequence
MTAPIDFYFDFSSPYGYFASTRIDDIAQKYGRYVIWHPILLGVVFKTTGSSPLPSIPLKG
DYCWRDFERTSEFNHIDYKRPTHFPLPTRHAARAMLWLQNNHGADVATAFAKAVYRALFV
DDINIAEPAELAKLAEPLGVDPIAMNEGANNYQIKDQLKAEIDVAMAKGVFGSPFVIVDG
EPFWGFDRFDQVEAYLKSRRQTELRAVGGNELNKEKKPA
Download sequence
Identical sequences A0A132HBZ0 Q1LS81
266264.Rmet_0109 WP_011515029.1.12480 WP_011515029.1.25839 WP_011515029.1.481 WP_011515029.1.66126 gi|94309054|ref|YP_582264.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]