SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011515951.1.12480 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011515951.1.12480
Domain Number 1 Region: 274-415
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.98e-35
Family Glutathione peroxidase-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011515951.1.12480
Sequence length 596
Comment cytochrome C biogenesis protein DipZ [Cupriavidus metallidurans]; AA=GCF_000196015.1; RF=representative genome; TAX=266264; STAX=119219; NAME=Cupriavidus metallidurans CH34; strain=CH34; AL=Complete Genome; RT=Major
Sequence
MLLLILSYLGGALTILSPCILPVLPFVFARADQPFARSGLPLLAGMGLTFAGVATLAAVG
GGWVAQANQYGRWLAIALLAVFGLTLLLPRLAERLMRPLVNAGSRLSNFAQADGKPASPA
SSFLLGIATGLLWAPCAGPILGLVLTGAALQGASLGTTLLLLAYAAGAATSLAVALLIGG
RVFTAMKRSLDAGEWVRRGIGVAMLAGVAAIALGLDTGILTRVSTVATGGLEQRLVDALG
HKDRSGGAMMAATSLPAEGGAMMMRAVDRPATLPVEGQFPGLNGAVEWLNSPPLTAEALR
GRVVLVDFWTYSCINCLRTLPYVKAWAEKYRDQGLVVIGVHAPEFAFERNIDNVRKATKD
LGVTYPVAIDNNYAIWRAFNNNYWPAHYFIDAQGRVRFHHFGEGEYEKSEAVIRQLLAEA
GHADVTKVAMTADNAMHGVEMPADASTLRSQETYVGYARAENFASPGGARPDQSKDYAAP
AHPTLNEWGLAGNWKVGEEQATLEQASGKIVYRFHARDLHLVLGPAADGKPVRFRVTIDG
KVPGASHGTDVAADGSGTVTGQRLYQLVRQQGDVADRTFAIEFLDPGVQAYAFTFG
Download sequence
Identical sequences Q1LP70
WP_011515951.1.12480 WP_011515951.1.25839 266264.Rmet_1170 gi|94310115|ref|YP_583325.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]