SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011519310.1.66126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011519310.1.66126
Domain Number 1 Region: 5-240
Classification Level Classification E-value
Superfamily Thioredoxin-like 5.18e-43
Family Glutathione peroxidase-like 0.0000032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011519310.1.66126
Sequence length 243
Comment glutathione amide-dependent peroxidase [Cupriavidus metallidurans]; AA=GCF_001598775.1; RF=na; TAX=1218106; STAX=119219; NAME=Cupriavidus metallidurans NBRC 101272; strain=NBRC 101272; AL=Contig; RT=Major
Sequence
MLQSREGQRVPNVTFRVRANNEWKDVTTAELFDGKTVVLFSLPGAFTPTCSSTHLPRYNE
LAPVFAKQGVDAILCVSVNDTFVMNEWAKDQESENIVMIPDGNGEFTDGMGMLVDKADLG
FGKRSWRYSMLVKDGVVDKMFIEPEEPGDPFKVSDADTMLNYIAPTAKQPDQVVVFSKIG
CSHCAKAKQLLSDNGFEYIDVPLENKIRGKVLGAVSGEMTAPQVFINGKLVGGAEALEQY
LAR
Download sequence
Identical sequences A0A132HGS2 Q1LDM5
gi|94313811|ref|YP_587020.1| WP_011519310.1.12480 WP_011519310.1.25839 WP_011519310.1.481 WP_011519310.1.52493 WP_011519310.1.66126 266264.Rmet_4889 gi|94313811|ref|YP_587020.1|NC_007974

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]