SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011530775.1.71355 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011530775.1.71355
Domain Number 1 Region: 129-172
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000549
Family Type I dockerin domain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011530775.1.71355
Sequence length 178
Comment hypothetical protein [Deinococcus geothermalis]; AA=GCF_000196275.1; RF=representative genome; TAX=319795; STAX=68909; NAME=Deinococcus geothermalis DSM 11300; strain=DSM 11300; AL=Complete Genome; RT=Major
Sequence
MKALIRPLLLALSLTAGAQAATVKFRPQGAQLTQAVQAALAAISTKETPITLDTSGGPIL
TLGGSGASAVPFNPDVVARTLSVGGERRIELNPQGPLPLAEAIRTTLASELGLKEWTVAA
ARTRLSGADLNGDGVIDLADLALLMENYGKTGAVLGDLNQDRKVDDADVRLFSAQYQP
Download sequence
Identical sequences Q1IXU3
319795.Dgeo_1646 gi|94985746|ref|YP_605110.1| WP_011530775.1.71355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]