SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011543724.1.11778 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011543724.1.11778
Domain Number 1 Region: 351-497
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 7.54e-28
Family HD domain 0.033
Further Details:      
 
Domain Number 2 Region: 236-330
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.52e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011543724.1.11778
Sequence length 547
Comment ribonuclease [Lactobacillus delbrueckii]; AA=GCF_001437195.1; RF=na; TAX=390333; STAX=1584; NAME=Lactobacillus delbrueckii subsp. bulgaricus ATCC 11842 = JCM 1002; strain=DSM 20081; AL=Scaffold; RT=Major
Sequence
MMNNTVFPLATVAVIFLISLVVGCLIGYAIRKNVWETRAENARQSVEAILAKAKAEVEVA
KAEIQAQKQAAEAVKRDAETEKKAKILEAQEEIRDYRQKVEDELNRRRDEAARKENRLQQ
KEDTLDHRSSLLDDREKQLTQRKAQIKQQEEKVAGLLEEAHGLVEKQNDKLLEISRLDEE
EAKKIVLAQVSDHLTKEKAELIRANEEEISARADRFAHQIIVDAIQSSAADTVAETTVSV
VDLPNDDMKGRIIGREGRNIRSFEAMTGVDLIIDDTPNTVTLSGFDSIRREVAKRALQKL
IKDGRIHPARIEEMVDKARKEVNDDIYEAGESALMELGIHRMNPELVKILGRLKYRTSYG
QNVLAHSIEVGKLAGTMAAELGLDEKLAVRAGLLHDIGKAIDHDIEGSHVEIGVELTRKY
HEPDLVVNAIAAHHGDVPKLSFIADLVVAADTISSARPGARSESLENYIRRLTELEDIAG
SYDGVKQAYAIQAGREVRVMVEPGKISDDEITVLAHEIRDRVEKELDYPGNIKITVIREK
RAVAVAK
Download sequence
Identical sequences A0A0U5K8A9 F0K0W0 Q04BJ7 Q1GB50
gi|104773710|ref|YP_618690.1| 321956.LBUL_0536 390333.Ldb0600 LdR4 WP_011543724.1.11778 WP_011543724.1.15974 WP_011543724.1.31115 WP_011543724.1.33988 WP_011543724.1.43242 WP_011543724.1.46396 WP_011543724.1.47362 WP_011543724.1.69250 WP_011543724.1.75338 WP_011543724.1.87012 WP_011543724.1.96615 gi|385815322|ref|YP_005851713.1| gi|116513707|ref|YP_812613.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]