SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011609946.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011609946.1.43450
Domain Number 1 Region: 7-45
Classification Level Classification E-value
Superfamily Rho N-terminal domain-like 0.0000196
Family Rho termination factor, N-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011609946.1.43450
Sequence length 731
Comment Rho termination factor-like protein [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MVQERPPLEEMTLRQLRKVASELGISRYSRMRKAQLLAAVIEAQGMNNLSSAPLSKLEVQ
ERAEAKKFESGEENNIDDFFSSVDEGLTDLPNGYAKSKIVLMPRDPEWAYAYWDISNELK
EELRSQGGQQLALRTYDVTDINLDSQSPHSIQEYPCDELAREWYIPIPVSDRNYTVEIGY
RCADGRWLVLSRSEEVNIPPVYPSDWIDEQFITVSWDEDLRGKTFMELFPASRQITFHDN
HDDIYQGMFGIAEAEDKRVSGSMFGSVQMVPGSGQMIEETLSSYAMVSGLGMWASGSNVS
CGNQMMSGVGQTMSGVGLNASGVGLTASGVGLTASGVGLTASGVGLNASGVGLTASGVGL
NASGVGLTASGVGLNASGVGLTASGVGLNASGVGLTASGVGLNASGVGLTASGVGLNASG
VGLTASGVGLNASGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGVGMNMSGVGLT
ASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGM
GMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNMSGVGLTASGMGMNM
SGVGLTASGMGMNMSGVGLTASGMGMNMSGIAGSIPPIRPRKFWLVADAELIIHGATEPD
ATVTIGGRPIKLNPDGTFRFQMAFPDGLIDYPIMAVAVDGEQNRSIHMQFTRETPERHTN
KKEEAILEWMS
Download sequence
Identical sequences Q11AD2
203124.Tery_0018 WP_011609946.1.43450 gi|113473954|ref|YP_720015.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]