SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011610001.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011610001.1.43450
Domain Number 1 Region: 280-495
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 3.55e-42
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.0052
Further Details:      
 
Domain Number 2 Region: 812-927
Classification Level Classification E-value
Superfamily CalX-like 1.29e-27
Family CalX-beta domain 0.00068
Further Details:      
 
Domain Number 3 Region: 705-815
Classification Level Classification E-value
Superfamily CalX-like 2.88e-27
Family CalX-beta domain 0.001
Further Details:      
 
Weak hits

Sequence:  WP_011610001.1.43450
Domain Number - Region: 513-686
Classification Level Classification E-value
Superfamily beta-Roll 0.000102
Family Serralysin-like metalloprotease, C-terminal domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_011610001.1.43450
Sequence length 928
Comment Na-Ca exchanger/integrin-beta4 [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MLEFLFTDNSDLSPISDVLNGVNTQPDPIKLQEVTLQTESKSTNFEVDKYNVETAFIPDK
YQTHLDKTLFTEPEILSKELTEKSVVLKYASQSQKDPLTGVEDGEQLVGKSITQEPPLLF
TEVSEKGKVKRNFKNSPIIRQRLVELDFNLLDNTDESDKIIRLNLFSDVTLDVKLGKVKS
SPNQQDWVRTGKVIGVENSQVILISSKDENNILGEIRLDYIEPGKQDQFYEVRSTDSDKF
VVNQLENPSFYHCYICGGIHEISNHQNNESNLEDNLGNGHFDSVFNKKVLRKTSLLSSNK
KINGLLTKTLWDTEEENIITYSFFSEQAINSYYGRENPLPVTDPIKINVKDIFNLFEQYI
DVRFQEVGDTADNYGQIRIMLSNGPLQNESRGYAYQPPGTSENPADGDIHLSSVYQDEYE
DVPGSYGYITIAHEIGHALGLKHPGNYSPGERAPFLSYAQDNNTNTMMTYIGLGGLNQYS
TTPMTYDIQSLQYLYGRNNNFNAENTTYSFDRVYGFFDGNQYLGSSDTETKLTLWDGGGF
DTIDLSKLPDLELADFTYDYRIDLREGGLITTTDAYNQHEYIAFQDTSGKKYKTSTSGTA
IAYGAVMENLINSRGDDLIYANNAANKFSGYTPGKYTGNDKIFRTNQKDVLDLSEYSSSQ
VKRRRKKKDLILDLGEENGSITISNYYGVKAKKRIEILYEKPTKPEITINDITVNEGNSG
TQRPQFTVNLSEPSESTVRVNFVTVNNRAKAGSDYRRRNGTITFKPGQTTKQITVPVLGD
TVDEFNEKFFVKLRKPRNATIADNKGVATIKNDDLTTISISDAKVTEGDSDENNGSFQVT
LDQKSPRTVKVDYETKDSTAINGSDYRSKTGTIKFKPGQTKKIIQIPIIGDEKVEKQEYF
WVELSNSQNADIDNKNRAGLGTIQDNDE
Download sequence
Identical sequences Q11A72
gi|113474014|ref|YP_720075.1| 203124.Tery_0100 WP_011610001.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]