SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011610907.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011610907.1.43450
Domain Number 1 Region: 57-199
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 2.88e-50
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.0000162
Further Details:      
 
Domain Number 2 Region: 4-54
Classification Level Classification E-value
Superfamily UBA-like 4.09e-19
Family TS-N domain 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011610907.1.43450
Sequence length 219
Comment elongation factor Ts [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MAEISAKLVKELREKTGAGMMDCKKALKETDGNIDKATDWLRQKGIASAGKLEGKVATEG
LVESYIHTGGRIGVLVEVNCQTDFVARNESFKELVKNVAMQIAACPQVEYVSVDDIPTEF
VESEKSIEMGREDLSNKPENIREKIVQGRIGKRLKELTLMDQPYIRDQNKTIEELIKETS
AQLGEKVQVRRFIRFVLGEGLEKQESNFAEEVAAQTGKK
Download sequence
Identical sequences Q116Q3
203124.Tery_1160 gi|113474933|ref|YP_720994.1| WP_011610907.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]