SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011612524.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011612524.1.43450
Domain Number 1 Region: 95-163
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 0.000000000000914
Family 7-Fe ferredoxin 0.096
Further Details:      
 
Weak hits

Sequence:  WP_011612524.1.43450
Domain Number - Region: 155-296
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 0.00688
Family D-ribulose-5-phosphate 3-epimerase 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011612524.1.43450
Sequence length 405
Comment 4Fe-4S ferredoxin [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MRERYYPLNSLKEGHWFKLICGASFQHLPTVRNLTLAYTLAGADCIDVAADPAAIAATKE
AVEVASQLKSWAKNHKFGYQARPLIMASINDGEDPHFRKAEFDSTICPIECWRPCEKVCP
AEAIVFFEKDNAINLGNSGVIDELCYGCGRCLSVCPNQLIQARSYVSTPSSIASLILQTG
VDAIEIHTQVGRETDFQRLWKSIKPWVNQLKLIAISCQDDEGLIEYLQSLYKIISPLPCS
LIWQTDGKPMSGDIGVGTTAATIKLSQKVLDAGLPGYVQLAGGTNNSTVVKLIALGLLAN
KSLKQDKDYINNFNIPISENKFVAGVAYGSYARILLSPILEKLEKMHKSQLEAIEFAYDT
ASVNTKDVNQNQSKKSQLTKLETIPEILWEAVSLANSLVSQIKRL
Download sequence
Identical sequences Q110A5
gi|113476581|ref|YP_722642.1| 203124.Tery_3014 WP_011612524.1.43450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]