SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_011613101.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_011613101.1.43450
Domain Number - Region: 140-223
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.0405
Family Collagen-binding domain 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_011613101.1.43450
Sequence length 232
Comment peptidase [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MHQTKFWAIAPFGLLTILGKPLLSPALPIHQAVVNFSYVDESSTKSEIFAQDTSFPKVTP
SPEMTPTLEDSPSPEMTPTLEDSPSPEMTPTLEDSPSPEMTPTLEDSPSPEMIPPTQEPE
IILQQPGMLSDDDLVLPSDESVYDEHTFEGTEGQVVTVTVESPDFDTYLAVFSPDTKLLG
EHDDISKKNTNSQLTITLPMTGKYRVIVNSYDKTGRGEYNLQVIQSGQTSDF
Download sequence
Identical sequences Q10YA4
WP_011613101.1.43450 gi|113477182|ref|YP_723243.1| 203124.Tery_3711

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]