SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_011613670.1.43450 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_011613670.1.43450
Domain Number 1 Region: 116-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 3.3e-61
Family NadC C-terminal domain-like 0.00000962
Further Details:      
 
Domain Number 2 Region: 7-115
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 7.46e-28
Family NadC N-terminal domain-like 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_011613670.1.43450
Sequence length 290
Comment nicotinate-nucleotide diphosphorylase (carboxylating) [Trichodesmium erythraeum]; AA=GCF_000014265.1; RF=representative genome; TAX=203124; STAX=1206; NAME=Trichodesmium erythraeum IMS101; strain=IMS101; AL=Complete Genome; RT=Major
Sequence
MKGVIPPKIILDNLLKDWLLEDIGRGDRTTSGLLLEDEVIVGTGHWLIKEPGVIAGLPIA
ARVFELLDQQVNFLPTVAEGEWCEKGTVVAKLDGSLDSLLTGERVALNLGMRLSGIATMT
RKYVEKIAGLPVQLVDTRKTTPGLRILEKYATQVGGAKNHRMGLDDGVMIKDNHIAAAGG
IGEAIAKVRERIPYPLTIEVETETLVEVERALEHQADIIMLDNMSVEVMEQAVKMIRQNN
SRIKIEASGNITLETIRNVAETGVDYISTSAPITRSTWLDLSMKITKAVS
Download sequence
Identical sequences Q10WN0
WP_011613670.1.43450 203124.Tery_4352 gi|113477756|ref|YP_723817.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]